[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55475.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   87->204 3c8iB PDBj 6e-20 41.7 %
:RPS:PDB   87->211 3c8iA PDBj 7e-38 41.0 %
:RPS:PFM   80->195 PF11580 * DUF3239 3e-17 47.0 %
:HMM:PFM   74->199 PF11580 * DUF3239 5.1e-52 55.6 126/128  
:HMM:PFM   19->74 PF03706 * UPF0104 4.2e-05 25.0 56/294  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55475.1 GT:GENE BAD55475.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 651893..652558 GB:FROM 651893 GB:TO 652558 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55475.1 LENGTH 221 SQ:AASEQ MRRFEFAVDRGHAHAVNEVLAAMRRRRVLAIATAIAAALITAGLIRLDHPWSYLLAVAFALCAITALWVALWAPHRFGIERLYAEGELVPAVVSQTRPRALVLLALVDVSGPDAADPRYALVTRKVRELPGHAKRRGERVPAVTVRTDGAPRRVGERRQSVSAMPIAWATRDPAVIDRARAAITEVEWRLLTENLDLAERVRRTAAKRLLLDNRYLPDLGS GT:EXON 1|1-221:0| TM:NTM 2 TM:REGION 28->50| TM:REGION 53->75| SEG 19->47|vlaamrrrrvlaiataiaaalitaglirl| BL:PDB:NREP 1 BL:PDB:REP 87->204|3c8iB|6e-20|41.7|115/129| RP:PDB:NREP 1 RP:PDB:REP 87->211|3c8iA|7e-38|41.0|122/127| RP:PFM:NREP 1 RP:PFM:REP 80->195|PF11580|3e-17|47.0|115/127|DUF3239| HM:PFM:NREP 2 HM:PFM:REP 74->199|PF11580|5.1e-52|55.6|126/128|DUF3239| HM:PFM:REP 19->74|PF03706|4.2e-05|25.0|56/294|UPF0104| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -----111111111----------------------1111-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 55.2 SQ:SECSTR ######################################################################################cEEEEEEEEEccccEEEEEEEEccccTTccccEEEEEEEEcccTTTcccTTcEEEEEEEE###ccEEEcccEEcEEEEEGGGTcccHHHHHHHHHHccHHHHHHHHHTGGGHHHHHTccccEEEc########## DISOP:02AL 151-157, 220-221| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHcccHHHEEEEEEEEccccccccccEEEEEEEEEEccccHHHHcccccEEEEEccccccccccHHHHcccccEEcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //