[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55476.1
DDBJ      :             putative translocator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   83->159 PF01810 * LysE 2e-10 52.0 %
:HMM:PFM   23->213 PF01810 * LysE 5.5e-26 26.5 189/192  
:BLT:SWISS 83->160 RHTB_SALTY 9e-11 47.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55476.1 GT:GENE BAD55476.1 GT:PRODUCT putative translocator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 652568..653221 GB:FROM 652568 GB:TO 653221 GB:DIRECTION + GB:PRODUCT putative translocator GB:PROTEIN_ID BAD55476.1 LENGTH 217 SQ:AASEQ MRHHRQMVPMANLLAFTAAATLIVVIPGPGVLFAIGRALALGRRAALVSVVGHAAGVLVCLLVVAVGLGTVLAASAVALTVVKIAGALYLIHLGVQAIRERKALHTALGAPVAAYADSRVFRQSVLVGVTNPKAIVFFSAVLPQFADPAGSLPVQFLILGAVFLTIALVSDSAWALLAASARSWFARSPRRLEAVGGAGGAMIVGLGASVALTGTAK GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 83->160|RHTB_SALTY|9e-11|47.3|74/206| TM:NTM 4 TM:REGION 13->35| TM:REGION 61->83| TM:REGION 157->179| TM:REGION 193->214| SEG 11->22|anllaftaaatl| SEG 36->47|gralalgrraal| SEG 50->82|vvghaagvlvcllvvavglgtvlaasavaltvv| SEG 167->191|alvsdsawallaasarswfarsprr| SEG 194->208|avggaggamivglga| RP:PFM:NREP 1 RP:PFM:REP 83->159|PF01810|2e-10|52.0|75/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 23->213|PF01810|5.5e-26|26.5|189/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 148 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------2----1-----------21-----------2------------------------------------------------------------------1------------------------------------------------------------------11--1---1----------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------1---2--222-1-2111-1------2-----1-----------------------------------------------------111--2222221111111111111113112121--111---111-1-2---1--1------------------1-------1--------11-1-----1-------------------------------1----------1111-----------------------------11-1---------------------------------------1111111111111111-------------------------------------111-------------------------------1---11211---1-----------1111211211211------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 99-119, 216-217| PSIPRED cccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //