[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55479.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:TM
:REPEAT 2|57->120|125->184
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55479.1 GT:GENE BAD55479.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 655909..656466 GB:FROM 655909 GB:TO 656466 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55479.1 LENGTH 185 SQ:AASEQ MNVFGERGFHVKFPGTRLLARLVLALLAAAALAVAMSGCSVIDDATKSDVAKTKVGDCINITDNSPTATEGEPIDCSSPKAVYKVHQTFDEATQCASNEYTSYTEQLPSGGTTFMCLAPNFAQDNCYNDVSTSPYMWVDCSSTEATFKVLQRIDGQTDELLCESGDEFLVVSDPKTLFCLGKPNA GT:EXON 1|1-185:0| TM:NTM 1 TM:REGION 18->40| NREPEAT 1 REPEAT 2|57->120|125->184| SEG 17->35|rllarlvlallaaaalava| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 184-185| PSIPRED cccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHccccccEEEEEcccccccccccccccccEEEEEccccHHHHHHHHHHcccHHHHHHcccccEEEEEcccEEEEEEcccc //