[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55481.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55481.1 GT:GENE BAD55481.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 658872..659060 GB:FROM 658872 GB:TO 659060 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55481.1 LENGTH 62 SQ:AASEQ MVNKSKKPYVDNGWPKVADGDHAVTELAASRAGNLSPFGEDTEFPVPAEQLPYRHPYTVINR GT:EXON 1|1-62:0| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -----11111-1-111111-1-1111111111111111-1------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEcc //