[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55483.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->75 PF07947 * YhhN 4.8e-05 26.3 57/186  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55483.1 GT:GENE BAD55483.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(660146..660430) GB:FROM 660146 GB:TO 660430 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55483.1 LENGTH 94 SQ:AASEQ MQDAIGVESTPVAIRRAHQFYGAAVTNSRQSATWLLKLALTLFTVGLVAIIAIFLTPILTDGEPGLWLYLTAMLTPLGFLCAIVFALWSGRRAR GT:EXON 1|1-94:0| TM:NTM 2 TM:REGION 35->57| TM:REGION 68->90| HM:PFM:NREP 1 HM:PFM:REP 17->75|PF07947|4.8e-05|26.3|57/186|YhhN| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 93-94| PSIPRED ccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //