[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55484.1
DDBJ      :             putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  370/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->66 1g6pA PDBj 1e-15 52.4 %
:RPS:PDB   1->65 1c9oA PDBj 2e-17 43.1 %
:RPS:SCOP  1->65 1c9oA  b.40.4.5 * 1e-17 43.1 %
:HMM:SCOP  1->66 2es2A1 b.40.4.5 * 6.4e-18 50.0 %
:RPS:PFM   3->65 PF00313 * CSD 5e-12 54.0 %
:HMM:PFM   1->62 PF00313 * CSD 3.7e-21 45.2 62/67  
:BLT:SWISS 4->66 CSP_THEMA 4e-15 52.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55484.1 GT:GENE BAD55484.1 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 660561..660977 GB:FROM 660561 GB:TO 660977 GB:DIRECTION + GB:PRODUCT putative cold shock protein GB:PROTEIN_ID BAD55484.1 LENGTH 138 SQ:AASEQ MPTGRVKWYDVEKGFGFLSQDEGEDVYVRSSALPEGVEGLKPGQRVEFGMAAGRRGPQALSLKLIEAPPSLRQGQDRGRKEPSGPRRTPDELHGMVEDMITLLETKVQPDLRKGRYPDRKTARTISEVVRAVARELDH GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 4->66|CSP_THEMA|4e-15|52.4|63/66| BL:PDB:NREP 1 BL:PDB:REP 4->66|1g6pA|1e-15|52.4|63/66| RP:PDB:NREP 1 RP:PDB:REP 1->65|1c9oA|2e-17|43.1|65/66| RP:PFM:NREP 1 RP:PFM:REP 3->65|PF00313|5e-12|54.0|63/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->62|PF00313|3.7e-21|45.2|62/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->65|1c9oA|1e-17|43.1|65/66|b.40.4.5| HM:SCP:REP 1->66|2es2A1|6.4e-18|50.0|66/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 768 OP:NHOMOORG 372 OP:PATTERN -------------------------------------------------------------------- 33--711111111111111-1211111111111222345333343311122135421311553133355511111111--------22-----------------------------------------------------------1-----------------------------------11111---123666666666666676213333667211435233333355-33333333333332222233-1-22-1-1-431122311--12341111111--------------1111111111111-1111111131221-2222222-1-1411211-3-----11--11241--421111121--------------------------------------11111111-----------------------------------------------------------------------------------11-----1----------------------1-----1-----------1---111-11111111-------231-----------16123255144342-53---------------------------222112122792111111111111112111-1--1---------1---11-------------------------------------------------------------------------------2---------22222---------------111111211--2-11--1112----1111---------233333333322233111111111-----111-----------------1-------------------------23-1121212--- ----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 49.3 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEEGGGcccccccccTTcEEEEEEEEETTEEEEEEEEEcTEE###################################################################### DISOP:02AL 67-89, 136-138| PSIPRED ccccEEEEEEccccEEEEEEccccEEEEEHHHHHccccccccccEEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcc //