[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55485.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->175 PF10969 * DUF2771 1e-20 56.1 %
:HMM:PFM   9->176 PF10969 * DUF2771 7.2e-60 57.1 156/161  
:BLT:SWISS 40->173 Y899_MYCBO 5e-16 39.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55485.1 GT:GENE BAD55485.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(660971..661528) GB:FROM 660971 GB:TO 661528 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55485.1 LENGTH 185 SQ:AASEQ MSRGRGRLIAALVGAGLLLLVAVVAGTVALAVRDAPDHDPEITAYAHGRAVTVPPYQFCDLRLLDEERLEMSNCRQGEPVELEVPPGYPLQLSLPRDIADAPWLAYLVYALPDDTTVTEVISHKDHPKGTPALTIDSQPAPELRLVGVEIQLPVPAIDEFGRETTVPHASWSISTQPRAGEAGDQ GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 40->173|Y899_MYCBO|5e-16|39.3|122/162| TM:NTM 1 TM:REGION 10->32| SEG 3->33|rgrgrliaalvgagllllvavvagtvalavr| SEG 60->70|dlrlldeerle| RP:PFM:NREP 1 RP:PFM:REP 40->175|PF10969|1e-20|56.1|123/162|DUF2771| HM:PFM:NREP 1 HM:PFM:REP 9->176|PF10969|7.2e-60|57.1|156/161|DUF2771| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111111-------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 177-185| PSIPRED cccccEEEEEHHHHHHHHHHHHHHHEEEEEEEcccccccEEEEEEcccEEEEEccEEEEccccccHHcccccccccccccEEEEcccccEEEEccHHHHHccEEEEEEEEcccccEEEEEEEcccccccEEEEEEcccccccccEEEEEEEEEEEEEcccccEEccccEEEEEEccccccccccc //