[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55487.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
b.69.2
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->253 2iwaA PDBj 2e-30 38.4 %
:RPS:PDB   101->257 3btaA PDBj 1e-14 10.6 %
:RPS:SCOP  140->218 1jjuB  b.69.2.2 * 4e-06 29.5 %
:HMM:SCOP  55->246 1l0qA2 b.69.2.3 * 2.7e-14 26.9 %
:RPS:PFM   24->256 PF05096 * Glu_cyclase_2 7e-63 53.9 %
:HMM:PFM   25->254 PF05096 * Glu_cyclase_2 9.1e-68 45.4 229/264  
:BLT:SWISS 34->253 QPCT_ARATH 6e-32 39.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55487.1 GT:GENE BAD55487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(663442..664215) GB:FROM 663442 GB:TO 664215 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55487.1 LENGTH 257 SQ:AASEQ MERNRRSSAVAVLVGALVAAGCGRPADPAPRLRIEVVATRPHDRTAFTQGLEVADGVLYEGTGLTGRSFVRATDLATGAELARADVPGEYFGEGITKAGATLWQLTWRDGVAFARDPATLRVLREVRYEGEGWGLCTRGDRLVMSDGSDTLTFRDPETFAVTGTRTLRDRRGARLNELDCAADGSVYANDYPSNRILRIDPDTGEVTGVADTGGLLTRAERADADVPNGIAALPGTDRFLLTGKYWPTMFEVRFVPE GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 34->253|QPCT_ARATH|6e-32|39.3|219/100| SEG 9->21|avavlvgalvaag| BL:PDB:NREP 1 BL:PDB:REP 34->253|2iwaA|2e-30|38.4|219/254| RP:PDB:NREP 1 RP:PDB:REP 101->257|3btaA|1e-14|10.6|132/1277| RP:PFM:NREP 1 RP:PFM:REP 24->256|PF05096|7e-63|53.9|232/251|Glu_cyclase_2| HM:PFM:NREP 1 HM:PFM:REP 25->254|PF05096|9.1e-68|45.4|229/264|Glu_cyclase_2| RP:SCP:NREP 1 RP:SCP:REP 140->218|1jjuB|4e-06|29.5|78/337|b.69.2.2| HM:SCP:REP 55->246|1l0qA2|2.7e-14|26.9|175/0|b.69.2.3|1/1|YVTN repeat-like/Quinoprotein amine dehydrogenase| OP:NHOMO 119 OP:NHOMOORG 111 OP:PATTERN -------------------------------------------------------------------- 1-2--111111111-------1----------11111111------------------------111--------------------------------111111----1--------------1-----------111--------------------------------------------111------------------------------------------------------------------------------------------------------------------1111111111111------------------------------------------------------------1--111-----------------------------------------------------------1-----------------------------------------------------------11----------------------------------------------------------------------------1---11-----------------1--1--------------------------------1---------------------------1---------------------------------------------------------------------------------11111111111--------------------------------------------1-------------------------------------------11111111--------------------------------------------------------------- --11----1---------------------------------------------------------------------------------------------------2------------------------------------------------------------------11111111111112-122122211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 87.2 SQ:SECSTR #################################EEEEEEEEccTTccEEEEEEccTEEEEEEccTTTcEEEEEETTTccEEEEEEccTTccEEEEEEETTccccccTTccEEEEcccccEEEEcccccccccEEEEEEETTEEcccccccHHHHHHTTccHHHEEEHHHHHHHHHHHHHHHHccccccEETTccETTccTcGGEEEEEEEcEEEEccEEEEEccccEEEETTcTcEEEccccccccTTTccccccEE DISOP:02AL 1-5| PSIPRED cccccccHHHHHHHHHHHHHccccccccccEEcEEEEEEccccccccEEEEEEEccEEEEEEccccccEEEEEEccccEEEEEEEccccEEEEEEEEcccEEEEEEEcccEEEEEEccccEEEEEEEEccccEEEEEcccEEEEEccccEEEEEEcccccEEEEEEEcccccccccEEEEccccEEEEEEEccccEEEEEccccEEEEEEEcccEEccccccccccccEEEEEccccEEEEEEcccccEEEEEEEcc //