[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55491.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->65 3e7qB PDBj 2e-09 38.1 %
:RPS:PDB   8->203 3bruA PDBj 2e-14 15.7 %
:RPS:SCOP  8->74 3c07A1  a.4.1.9 * 2e-13 34.3 %
:HMM:SCOP  8->74 1z0xA1 a.4.1.9 * 1.3e-13 35.8 %
:HMM:SCOP  83->209 2gfnA2 a.121.1.1 * 7.8e-08 25.2 %
:RPS:PFM   14->60 PF00440 * TetR_N 2e-05 38.3 %
:HMM:PFM   14->60 PF00440 * TetR_N 8.8e-15 38.3 47/47  
:HMM:PFM   108->154 PF04218 * CENP-B_N 0.00034 26.1 46/53  
:BLT:SWISS 11->189 MTRR_NEIGO 4e-10 25.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55491.1 GT:GENE BAD55491.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(669317..669943) GB:FROM 669317 GB:TO 669943 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55491.1 LENGTH 208 SQ:AASEQ MSSRLSVEERRAHLIEAAIGLAEKKGVAGVTTRDVAQAAGVSLGVVHYCFENKDALMTELVKALSMELRDSVDADETVWQDVGSGKDALQKLVRAGLELMWLNIEATPERQLLTYETTTYALREGEQTPAKLAIAREQYTFNDSTVADILDHARDATGTQWSVPVQTLSRFTLNVIDGLVLRWLVDNDSAAVRDQLDLLAEMVAGYAA GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 11->189|MTRR_NEIGO|4e-10|25.0|172/210| BL:PDB:NREP 1 BL:PDB:REP 3->65|3e7qB|2e-09|38.1|63/210| RP:PDB:NREP 1 RP:PDB:REP 8->203|3bruA|2e-14|15.7|185/188| RP:PFM:NREP 1 RP:PFM:REP 14->60|PF00440|2e-05|38.3|47/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 14->60|PF00440|8.8e-15|38.3|47/47|TetR_N| HM:PFM:REP 108->154|PF04218|0.00034|26.1|46/53|CENP-B_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 1 RP:SCP:REP 8->74|3c07A1|2e-13|34.3|67/75|a.4.1.9| HM:SCP:REP 8->74|1z0xA1|1.3e-13|35.8|67/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 83->209|2gfnA2|7.8e-08|25.2|119/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 20 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------2172-----1------1----1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 99.0 SQ:SECSTR ##ccccHGGHHHHHHHHHHHHHHHccTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHHHHHTTTTccccHHHHHHHHHHHHHHHTGGccTHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccTTccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHGGGcHTTcH DISOP:02AL 1-12| PSIPRED ccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHc //