[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55493.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->79 PF10745 * DUF2530 3.4e-36 59.2 76/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55493.1 GT:GENE BAD55493.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(672163..672402) GB:FROM 672163 GB:TO 672402 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55493.1 LENGTH 79 SQ:AASEQ MTPNVPQIPPRLTDPRPVLAVGTLLWLVALVVVWVGGPRWEAARPVCVMGLVVGLIGLVIFLVQRRAARRGDKGAQTGL GT:EXON 1|1-79:0| TM:NTM 2 TM:REGION 14->35| TM:REGION 43->64| SEG 18->37|vlavgtllwlvalvvvwvgg| SEG 50->63|glvvgliglviflv| HM:PFM:NREP 1 HM:PFM:REP 3->79|PF10745|3.4e-36|59.2|76/77|DUF2530| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 68-79| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //