[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55495.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  210/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->57 PF03733 * DUF307 8e-11 59.2 %
:RPS:PFM   71->122 PF03733 * DUF307 8e-08 50.0 %
:HMM:PFM   6->57 PF03733 * DUF307 7.1e-25 51.9 52/53  
:HMM:PFM   70->122 PF03733 * DUF307 4.1e-21 52.8 53/53  
:BLT:SWISS 4->124 YCCF_SHIFL 2e-20 39.7 %
:TM
:REPEAT 2|6->61|70->125

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55495.1 GT:GENE BAD55495.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(672923..673324) GB:FROM 672923 GB:TO 673324 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55495.1 LENGTH 133 SQ:AASEQ MKPIQLVLNILWLIFAGFWMALGYIVAGIICCVLIITIPFGIASFRIAAYVLWPFGRTTVEKPGAGAGSLIGNIIWFVVAGWWLAIGHLLTSIPLFVSIIGIPFGWANLKFIPLSLFPLGREIVDSDQPFGAR GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 4->124|YCCF_SHIFL|2e-20|39.7|121/148| TM:NTM 3 TM:REGION 8->30| TM:REGION 38->60| TM:REGION 74->96| NREPEAT 1 REPEAT 2|6->61|70->125| RP:PFM:NREP 2 RP:PFM:REP 9->57|PF03733|8e-11|59.2|49/53|DUF307| RP:PFM:REP 71->122|PF03733|8e-08|50.0|52/53|DUF307| HM:PFM:NREP 2 HM:PFM:REP 6->57|PF03733|7.1e-25|51.9|52/53|DUF307| HM:PFM:REP 70->122|PF03733|4.1e-21|52.8|53/53|DUF307| OP:NHOMO 214 OP:NHOMOORG 214 OP:PATTERN ---------------------------1---------------------------------------- ----1111111----1111-11--1111111111111111-111-11-1---111--1--11--1111111111111---1-------1111-1-------------1-1---------------------------------------111-----1-11----1---------------------------------------------------------------------------------------1----------------1-----------1111-11------------------1--------------1------------1-1-----111--1-------11------------------111--------111--111111-----------------------------------------------------------------1-----------------------------------------------------------------111-----------------------------------------------11-11----------------------------------------------111--------1111111111111111111-------------11111111111111111-111111111111111111111111----1--------------11111111--111111111111---1-----------------111--------1---------------------------------------111-1111111111----------------------------------1-------------------------------------- -------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1----------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 131-133| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccc //