[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55497.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   47->76 PF10801 * DUF2537 1e-05 66.7 %
:HMM:PFM   16->96 PF10801 * DUF2537 3e-36 59.3 81/84  
:BLT:SWISS 47->76 Y906_MYCBO 1e-07 63.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55497.1 GT:GENE BAD55497.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 674202..674507 GB:FROM 674202 GB:TO 674507 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55497.1 LENGTH 101 SQ:AASEQ MRGMTMTENPPVQDPTPWAAGITVTVLVAALATVAVYAFGAALAQVHPALAVLINLIAVGGAAPTAWRWRHTPVTRWVLLGCAVGVGLGWLGLIIAGLAAL GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 47->76|Y906_MYCBO|1e-07|63.3|30/94| TM:NTM 3 TM:REGION 17->39| TM:REGION 44->66| TM:REGION 76->98| SEG 19->46|aagitvtvlvaalatvavyafgaalaqv| SEG 77->100|wvllgcavgvglgwlgliiaglaa| RP:PFM:NREP 1 RP:PFM:REP 47->76|PF10801|1e-05|66.7|30/84|DUF2537| HM:PFM:NREP 1 HM:PFM:REP 16->96|PF10801|3e-36|59.3|81/84|DUF2537| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //