[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55498.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.74.2
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   14->57 1b4bA PDBj 7e-04 39.5 %
:RPS:SCOP  14->57 1b4bA  d.74.2.1 * 3e-04 39.5 %
:HMM:PFM   10->57 PF02863 * Arg_repressor_C 7.4e-05 35.7 42/70  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55498.1 GT:GENE BAD55498.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(674516..675265) GB:FROM 674516 GB:TO 675265 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55498.1 LENGTH 249 SQ:AASEQ MPEMLSRASTVWYVDAADPLAVLRANPDPDPGAAQALAKQLHEDYDVVPKMVGTLAGCAGPDADEVYIGCYPGVTVVCSRQVRLPRPTALPELLIRPLASEQTYLVAFDVTMGWGAFAQWERGEFRRAFSSSRVNILEDEGLPLVWERPFWAGEHPVQWRAGELPDPQCLPFDPPDFADAANNEWLGFHYRAPAAEGALVPGDVAVCGFTLVPKGQTLTDDAPDDPAPHAPPRPQRRGLLGWLRGDHVG GT:EXON 1|1-249:0| SEG 220->237|ddapddpaphapprpqrr| RP:PDB:NREP 1 RP:PDB:REP 14->57|1b4bA|7e-04|39.5|38/71| HM:PFM:NREP 1 HM:PFM:REP 10->57|PF02863|7.4e-05|35.7|42/70|Arg_repressor_C| RP:SCP:NREP 1 RP:SCP:REP 14->57|1b4bA|3e-04|39.5|38/72|d.74.2.1| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----111111111----------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 15.3 SQ:SECSTR #############EEEETTEEEEEEcT####TcHHHHHHHH##HHHccTTEEEEEEc################################################################################################################################################################################################ DISOP:02AL 1-5, 227-229, 247-249| PSIPRED cccHHcccEEEEEEEcccHHHHHHccccccHHHHHHHHHHHcccccccEEEEEEEccccccccccEEEEEccccEEEEEEEHcccccccccHHHHHccccccEEEEEEcccccccEEEEEEccEEEEHHHHHHHHHHHccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHccEEEEccccccccccccEEEEEEEEccccccccccccccccccccccccccccEEEccccccc //