[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55502.1
DDBJ      :             putative peptidyl-prolyl cis-trans isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  465/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:119 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->117 2ke0A PDBj 9e-21 50.0 %
:RPS:PDB   14->116 3chxA PDBj 1e-21 14.6 %
:RPS:SCOP  1->116 1q6hA  d.26.1.1 * 1e-25 40.9 %
:HMM:SCOP  14->119 1q6hA_ d.26.1.1 * 4.2e-31 48.6 %
:RPS:PFM   33->116 PF00254 * FKBP_C 5e-11 47.0 %
:HMM:PFM   25->116 PF00254 * FKBP_C 2.1e-26 49.5 91/96  
:BLT:SWISS 1->118 FKBP_CORGL 1e-50 73.7 %
:PROS 41->47|PS00307|LECTIN_LEGUME_BETA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55502.1 GT:GENE BAD55502.1 GT:PRODUCT putative peptidyl-prolyl cis-trans isomerase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(678653..679012) GB:FROM 678653 GB:TO 679012 GB:DIRECTION - GB:PRODUCT putative peptidyl-prolyl cis-trans isomerase GB:PROTEIN_ID BAD55502.1 LENGTH 119 SQ:AASEQ MTKPVVEFQAGPPPTELVVKDIIVGEGKEAVPGGTVEVHYVGVEFDTGEEFDSSWSRGESITFPLRGLIQGWQDGIPGMKVGGRRQLTIPPELAYGPAGSGHKLSGKTLVFVIDLLNAN GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 1->118|FKBP_CORGL|1e-50|73.7|118/118| PROS 41->47|PS00307|LECTIN_LEGUME_BETA|PDOC00278| BL:PDB:NREP 1 BL:PDB:REP 17->117|2ke0A|9e-21|50.0|100/117| RP:PDB:NREP 1 RP:PDB:REP 14->116|3chxA|1e-21|14.6|103/362| RP:PFM:NREP 1 RP:PFM:REP 33->116|PF00254|5e-11|47.0|83/91|FKBP_C| HM:PFM:NREP 1 HM:PFM:REP 25->116|PF00254|2.1e-26|49.5|91/96|FKBP_C| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 1->116|1q6hA|1e-25|40.9|115/210|d.26.1.1| HM:SCP:REP 14->119|1q6hA_|4.2e-31|48.6|105/210|d.26.1.1|1/1|FKBP-like| OP:NHOMO 1532 OP:NHOMOORG 650 OP:PATTERN -------------------------------------------------------------------- -12-2111111111211----2--22-----1222221111211232232122222221122222-122322222222----------3222-333---112211122-1-111111---1111------------111-----2-1111111111111111111111111111111111111111----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-32221------111111-11111------------11111111------------------111----------11111111-111--1---------------------------------2-------1111112----11221111-11122222-12221222222212-11111213211222221111122-2121----1----52221133-222233-----------------------------332212313235455444555554554566---1--2-1----22222222222222222-2222222222222222222222222222222222222222222211221212-222222212222--12111111--111112212222111112222333332311133222243233333423331--------2333333333333331122222222----111-221111----------------------------------------------12- ----433-52224423312231323221222222223333233222222222221223323331223311231322311331121-33-33232322-33223232-4G459D54B42-3134245283GO7-754-31372443332123-26221464454564353353263-766P43237798C2B84836348 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 98.3 SQ:SECSTR ##cHHHHHTTTcEcccccccccccEEEcccccEEEEcccccccccccTTccccccTTccTTccccccccTTccccccEEEEccHHHHTTcGGGGcccccccccEEcccccccEEEEEEc PSIPRED ccccEEEEcccccccccEEEEEEcccccccccccEEEEEEEEEEccccEEEEccccccEEEEEEcccccHHHHHHHcccccccEEEEEEcHHHcccccccccccccccEEEEEEEEEcc //