[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55510.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->60 PF04335 * VirB8 3.1e-05 33.9 59/212  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55510.1 GT:GENE BAD55510.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(686371..686757) GB:FROM 686371 GB:TO 686757 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55510.1 LENGTH 128 SQ:AASEQ MNRFRTRTRLAALTAGAAASAAVLLGTGVAAAGPLESAEPLLSTDCTFAQVDAALHAEAPELAAMLDAYPAQKAELQRRFDQPVEQRRADFQMLIEQNPDLAAQAESDPRAAQLSQALAAVAATCHNY GT:EXON 1|1-128:0| SEG 3->33|rfrtrtrlaaltagaaasaavllgtgvaaag| SEG 53->64|aalhaeapelaa| SEG 111->123|aaqlsqalaavaa| HM:PFM:NREP 1 HM:PFM:REP 2->60|PF04335|3.1e-05|33.9|59/212|VirB8| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHccc //