[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55513.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->125 1a0kA PDBj 2e-17 22.0 %
:RPS:SCOP  10->125 1skoB  d.110.7.1 * 8e-19 17.0 %
:HMM:SCOP  5->133 1j3wA_ d.110.7.1 * 4.1e-30 43.0 %
:RPS:PFM   23->102 PF03259 * Robl_LC7 2e-09 46.8 %
:HMM:PFM   12->103 PF03259 * Robl_LC7 5.3e-25 31.9 91/91  
:BLT:SWISS 21->123 Y1340_METJA 7e-06 27.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55513.1 GT:GENE BAD55513.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 693018..693431 GB:FROM 693018 GB:TO 693431 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55513.1 LENGTH 137 SQ:AASEQ MNPDLGGTNRQLDWLVSNFANEVPGVAHAVLVSADGLLMAASAQLPVDRAEQLSAVTAGLASLSVGVSNLFEGGTVLQSVVEMEHGYLLLMAVGDGSYLAVLTNTSCDIGQVGYEMALLVERVGQTVQATPRVTMGS GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 21->123|Y1340_METJA|7e-06|27.7|101/114| RP:PDB:NREP 1 RP:PDB:REP 26->125|1a0kA|2e-17|22.0|100/130| RP:PFM:NREP 1 RP:PFM:REP 23->102|PF03259|2e-09|46.8|79/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 12->103|PF03259|5.3e-25|31.9|91/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 10->125|1skoB|8e-19|17.0|112/116|d.110.7.1| HM:SCP:REP 5->133|1j3wA_|4.1e-30|43.0|128/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 122 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----8----------1111-11--1111111111116112-5462---1-----------64--575DBB6---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 78.1 SQ:SECSTR ######################GTcccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHHHT######## DISOP:02AL 1-7, 130-137| PSIPRED ccccccccccHHHHHHHHHHHHcHHHEEEEEEcccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccc //