[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55514.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->124 PF05331 * DUF742 5e-17 53.3 %
:HMM:PFM   12->123 PF05331 * DUF742 4e-37 50.5 111/114  
:BLT:SWISS 48->119 PARB_MYCLE 5e-04 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55514.1 GT:GENE BAD55514.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 693439..693813 GB:FROM 693439 GB:TO 693813 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55514.1 LENGTH 124 SQ:AASEQ MDIEDHRVGSAEPSLVRPYSLTAGRTRPKVELALEALVASQPVALERQFELTNIETSIVELCRESPSVAEVAARLGIPIGVARVLVADLIDAGHVRVSATLKEDSSDDERRELIERVLSGLRRI GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 48->119|PARB_MYCLE|5e-04|30.4|69/333| RP:PFM:NREP 1 RP:PFM:REP 15->124|PF05331|5e-17|53.3|107/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 12->123|PF05331|4e-37|50.5|111/114|DUF742| OP:NHOMO 77 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ----4----------1111-11--1111111111113111-234----1-----------42--4646544---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccccEEEEEcccccccccccEEEEEEEccccccccccccHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHcc //