[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55515.1
DDBJ      :             putative ATP/GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  74/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->171 3bc1A PDBj 9e-07 21.5 %
:RPS:SCOP  2->168 1zd9A1  c.37.1.8 * 9e-07 18.1 %
:HMM:SCOP  1->155 1e2kA_ c.37.1.1 * 1.1e-17 28.6 %
:RPS:PFM   2->124 PF03029 * ATP_bind_1 4e-05 40.2 %
:HMM:PFM   2->167 PF03029 * ATP_bind_1 6.8e-29 37.3 161/238  
:BLT:SWISS 1->124 Y1339_METJA 1e-08 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55515.1 GT:GENE BAD55515.1 GT:PRODUCT putative ATP/GTP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 693866..694396 GB:FROM 693866 GB:TO 694396 GB:DIRECTION + GB:PRODUCT putative ATP/GTP-binding protein GB:PROTEIN_ID BAD55515.1 LENGTH 176 SQ:AASEQ MVAGGFGVGKTTLVGAVSEIVPLRTEALVTNASAGIDNLTGIPMKSTTTVAMDFGRISLADDLVLYLFGTPGQYRFWFMWDDLIRGAIGAVVLVDTRRLEDSFAAVDYFEARNLPFLVALNEFDDAPRYPIEDIRQALAVSADVPILSIDARRREPAKQALVSLTEYALRKVMQGY GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 1->124|Y1339_METJA|1e-08|33.7|104/154| RP:PDB:NREP 1 RP:PDB:REP 2->171|3bc1A|9e-07|21.5|158/185| RP:PFM:NREP 1 RP:PFM:REP 2->124|PF03029|4e-05|40.2|122/240|ATP_bind_1| HM:PFM:NREP 1 HM:PFM:REP 2->167|PF03029|6.8e-29|37.3|161/238|ATP_bind_1| GO:PFM:NREP 1 GO:PFM GO:0000166|"GO:nucleotide binding"|PF03029|IPR004130| RP:SCP:NREP 1 RP:SCP:REP 2->168|1zd9A1|9e-07|18.1|149/164|c.37.1.8| HM:SCP:REP 1->155|1e2kA_|1.1e-17|28.6|154/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 170 OP:NHOMOORG 85 OP:PATTERN ----------------11----------------1---1-11-1--1--------------------- ----9----------1111-11--111111111111511214352---1-----------53--465BDA6------------1-111----------------------------------------------2-11122---3----2---11----------1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----11---------------11111---------------------------------------------------------------11--------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 98.9 SQ:SECSTR EEEccTTccHHHHHHHHHHHHHHTHHHHHHccccccccccccEEEEEEEEEEcTTcccccEEEEEEEEEEcccGGGHHHHHHTTTTccEEEEEEETTccHHHHHTHHHHcccccccEEEEEEcTTGGccccHHHHHHHHHHHTccEEEccTTTcTTHHHHHHHHHHHHHHHccc## DISOP:02AL 175-176| PSIPRED cEEccccccHHHHHHHHHccccccccHHHHHcccccccccccccccEEEEEEEEEEEEEcccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHccc //