[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55518.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  206/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:374 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->217 1w4xA PDBj 8e-17 29.9 %
:RPS:PDB   4->308 1dxlA PDBj 2e-17 15.5 %
:RPS:SCOP  5->236 1gosA1  c.3.1.2 * 2e-10 13.6 %
:HMM:SCOP  1->365 1f8rA1 c.3.1.2 * 4.5e-38 31.9 %
:RPS:PFM   4->217 PF00743 * FMO-like 1e-20 30.4 %
:HMM:PFM   6->228 PF07992 * Pyr_redox_2 4.1e-14 26.3 156/202  
:BLT:SWISS 6->203 CZCO_GEOKA 5e-17 32.0 %
:BLT:SWISS 179->234 FENR_ACIC1 6e-04 35.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55518.1 GT:GENE BAD55518.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(696869..697993) GB:FROM 696869 GB:TO 697993 GB:DIRECTION - GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD55518.1 LENGTH 374 SQ:AASEQ MPSDYDILVIGAGQAGLSAAYHLRRLGLVPERDFLVVDHADGPGGAWRHRWPSLTLSTVNGVHDLPGMSFAETLPPGSANAQAATAVPHYYELYEKRFDLRVHRPVSVRVVCDRTADGTRCDGRGEVLHAETDTAGTLRVRGLINGTGTWERPFVPRYRGQESFTGRQLHTRDYHDAAEFAGKHVVVVGGGISAVQLLDEISQVTSTTWVTRREPVFREGEFTPEAGRAAVAQVEDRVRRGLPPGSVVSVTGLLWNDRLRAAQRRGALARRPMFDHIEPDGVRWADGSFQHADVILWATGFRSALDHLAPLRLRGPGGGITMTGRLSTQVAADPRIHLIGYGPSASTIGANRAGRAAAVELTAHLGIARLTDPR GT:EXON 1|1-374:0| BL:SWS:NREP 2 BL:SWS:REP 6->203|CZCO_GEOKA|5e-17|32.0|178/348| BL:SWS:REP 179->234|FENR_ACIC1|6e-04|35.7|56/325| SEG 258->271|rlraaqrrgalarr| SEG 310->319|plrlrgpggg| BL:PDB:NREP 1 BL:PDB:REP 2->217|1w4xA|8e-17|29.9|204/533| RP:PDB:NREP 1 RP:PDB:REP 4->308|1dxlA|2e-17|15.5|277/467| RP:PFM:NREP 1 RP:PFM:REP 4->217|PF00743|1e-20|30.4|204/247|FMO-like| HM:PFM:NREP 1 HM:PFM:REP 6->228|PF07992|4.1e-14|26.3|156/202|Pyr_redox_2| GO:PFM:NREP 4 GO:PFM GO:0004499|"GO:flavin-containing monooxygenase activity"|PF00743|IPR000960| GO:PFM GO:0050660|"GO:FAD binding"|PF00743|IPR000960| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00743|IPR000960| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00743|IPR000960| RP:SCP:NREP 1 RP:SCP:REP 5->236|1gosA1|2e-10|13.6|220/385|c.3.1.2| HM:SCP:REP 1->365|1f8rA1|4.5e-38|31.9|313/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 728 OP:NHOMOORG 309 OP:PATTERN -------------------------------------------------------------------- --1-52-2223112B6422-2B--772222219AAA7AKD-2-13-111111223-22--2-1-2233522-------------------------1------1-1--1-------------------------------2---1-1-11-----11------1------1------------1---------1111111-1111111111---111111-----------1------------------------------------------------------------------------------------------------------------------------------------------------1--2-----1-2-------11-----------1-21--3-22125-2--2--1-----1--11111-------22222222211---1--------------------------------621--1-1-3122332-11-222-1111-14552122--21--7---111-11----------------11------------------------------1--1------------------------------1-12-1------------------11-1--------------------------------------------------112----2------------------------------------------------1111-51-2---------------32123----1--2222-32-32---1---------------------------21----------------------------------------------------------------------- ----1---------1541296748788441222322111111-2331-2414A5--1111-1--2-1-------1--------------6524121-----11----13-95-2115--1--3-531--1----1-12--31112---1-4--2-1242-22-42------1112-11-------4134133------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 371 STR:RPRED 99.2 SQ:SECSTR ccccccEEEEcccHHHHHHHHHHHHHTcccTGcEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHTHHHHTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEccEEEEETTEEEEcccccccEEEEccEEEEcccEEcEEccEcccTTcccccccEEcHHHHTTccccccEEEEccccHHHHHHHHHHHHHTcEEEEEcccccccTTTccHHHHHHHHHHHHHccccEEccEEEEEEEcccEccTTcEEEcEETTEEccccEEEEEEEccccccEEEEEcEEEccccEEEccTTcEEEEEccccccccccTTccccccTTccccccccccccccccccTTcTTHHHHHHHHHHHHHHH### DISOP:02AL 370-374| PSIPRED cccccEEEEEcccHHHHHHHHHHHHHcccccccEEEEEcccccccEEEEEcccEEEccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccccEEEEcccccHHHccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccHHccccccEEccccHHHHccccEEEEEcEEEEEccEEEEccccEEEEEEEEEEEcccccccccccEEEEEccccEEEcccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHccccccccc //