[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55521.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55521.1 GT:GENE BAD55521.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 700025..700243 GB:FROM 700025 GB:TO 700243 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55521.1 LENGTH 72 SQ:AASEQ MAMSFADNLKGLIGKGKEAAAKNSDKINQAVDKAGTFLDQKTQGKYSDKIEKGKQAAKKVVPPEQPGHNPHA GT:EXON 1|1-72:0| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------1-------111----1---1------1---1-11-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-6, 57-72| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccc //