[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55540.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  97/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->103 HAPMO_PSEFL 5e-10 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55540.1 GT:GENE BAD55540.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 722919..723353 GB:FROM 722919 GB:TO 723353 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55540.1 LENGTH 144 SQ:AASEQ MFLMYRPNTNLGTGSISYMLERQARYIRQAVEVLARDPGGVLEIRAEVEQRYDDEMRRRLAGSAWAGCVSWYKSASGRISSNWPGLVSEYSRRTATSSLADFQADAVSRESGVAERDTFLTSVQEVPTVVATLFLDNVQERWVR GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 1->103|HAPMO_PSEFL|5e-10|34.0|103/640| OP:NHOMO 203 OP:NHOMOORG 130 OP:PATTERN -------------------------------------------------------------------- ----21----1---43211-14--6211111325455245---1-------------1----2-1211111---------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------11-11-11--2----------------1-------------------1-----1------------------------------------111--2122222-11-11211111-13221111--22--2---------------------------1------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------31-----------------22122-1-----2212-2121--------------------------------------------------------------------------------------------------------- --------------1111-212-11-11111111111111111-11-1-1-1----------------------------------------1------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 144-145| PSIPRED cEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccHHHHHHHHccccHHHcEEEEccccccccccccccccEEEccEEHHHHHHHHHHHHHcc //