[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55547.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55547.1 GT:GENE BAD55547.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 728417..728860 GB:FROM 728417 GB:TO 728860 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55547.1 LENGTH 147 SQ:AASEQ MALKGYRFPIAHAEAFPQGLVLVGQIEPLIKYNPDRNAVPEQQIDYNPKTGAGSRLPMWKATVTDPSETNAKRASFQLIFLSEVEPVPSTPEVLPGMRQIELEGLLAEPKVMGTGEFKYQGFVFYAGGIKGDNSGARGKSAAESRAA GT:EXON 1|1-147:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 131-147| PSIPRED cccccccccccccccccccEEEEEEccEEEEEcccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEEEccccccccHHHccccEEEEEEcEEcccEEEccccEEEEEEEEEEccccccccccccccccccccc //