Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55550.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:HMM:PFM   8->26 PF01214 * CK_II_beta 0.00093 42.1 19/184  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55550.1 GT:GENE BAD55550.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 730786..731112 GB:FROM 730786 GB:TO 731112 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55550.1 LENGTH 108 SQ:AASEQ MKRGFQTESHVVVYCDICGDVYTERNGGLTCFATTSEAIGYLTRRAGIGWVYDGDRVICDACLATRECQDHGHDFPARWTTTVWPLGEMTHTRACTRCGVPENETEVL GT:EXON 1|1-108:0| HM:PFM:NREP 1 HM:PFM:REP 8->26|PF01214|0.00093|42.1|19/184|CK_II_beta| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 103-108| PSIPRED ccccccccccEEEEEEccccEEEcccccEEEEEEcHHHHHHHHHHccccEEEEccEEEEHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHccccccccccc //