[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55552.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->47 PF04221 * RelB 0.00061 41.9 31/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55552.1 GT:GENE BAD55552.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 731306..731461 GB:FROM 731306 GB:TO 731461 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55552.1 LENGTH 51 SQ:AASEQ MTRKPKPTAPQVNPIVRAAAEKVTRTKRRTPTDLHAPRPDQLTLFDPKDLR GT:EXON 1|1-51:0| HM:PFM:NREP 1 HM:PFM:REP 16->47|PF04221|0.00061|41.9|31/83|RelB| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED cccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEccccccc //