Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55553.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55553.1 GT:GENE BAD55553.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 731458..732096 GB:FROM 731458 GB:TO 732096 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55553.1 LENGTH 212 SQ:AASEQ MTTNTSTRNPERDPMDVLGLAVIKLVSGLLTAAFLALSWAVLFPMVSLPIVAAVGAGVFVHPWAGVGVAGGAVAGMVLWRRRSPETFERWLTARARARALAWVRYRRRWIPLMTACNLVVREGERLMVPRWLEVWIGEADDLVLVRMLPGQCPEDFENRADRLAHAFGADECRVRVDGPGVIELNFRYDDALAAPVDLPHIDGGLGWTKDAA GT:EXON 1|1-212:0| TM:NTM 2 TM:REGION 18->40| TM:REGION 53->75| SEG 64->77|agvgvaggavagmv| SEG 89->109|rwltarararalawvryrrrw| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----1----------1--------1--------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 210-212| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHccccccEEEEccccEEEEEEEEcccccccccccccccccccccccc //