[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55555.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->54 PF05930 * Phage_AlpA 1.2e-08 32.7 49/51  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55555.1 GT:GENE BAD55555.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 733799..734002 GB:FROM 733799 GB:TO 734002 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55555.1 LENGTH 67 SQ:AASEQ MEAETYLRAKDCEALTGIPEATWRWWAHVGKGPASFKLGPRRRVWRKSVVLAWIVEQEQLTGTGEAA GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 6->54|PF05930|1.2e-08|32.7|49/51|Phage_AlpA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------1------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 61-67| PSIPRED ccccHHccHHHHHHHHcccHHHHHHHHHccccccEEEEcccEEEHHHHHHHHHHHHHHHcccccccc //