[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55561.1
DDBJ      :             putative peptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  671/915 : Eukaryota  5/199 : Viruses  7/175   --->[See Alignment]
b.84.3
:252 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   140->240 2hsiB PDBj 1e-12 37.8 %
:RPS:PDB   128->240 2b13A PDBj 8e-25 37.2 %
:RPS:SCOP  129->238 1qwyA  b.84.3.2 * 5e-23 38.2 %
:HMM:SCOP  55->238 1qwyA_ b.84.3.2 * 2.8e-40 31.0 %
:RPS:PFM   139->228 PF01551 * Peptidase_M23 4e-16 46.7 %
:HMM:PFM   139->234 PF01551 * Peptidase_M23 3.4e-30 43.2 95/96  
:BLT:SWISS 128->242 YOMI_BACSU 3e-20 48.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55561.1 GT:GENE BAD55561.1 GT:PRODUCT putative peptidase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 740715..741473 GB:FROM 740715 GB:TO 741473 GB:DIRECTION + GB:PRODUCT putative peptidase GB:PROTEIN_ID BAD55561.1 LENGTH 252 SQ:AASEQ MRAAASAAVAAGALVGVAAQVAPALAAASPLAPSRNTEAAEETIAFKGTAEIPAAEAKQIAEPAPAADPAPVTQVAAPVAQNVAQQPFGIPNLPPEIAAPLAQVEDVLKNVQQHVAPPVAVRPVAGAISSGYGTRWGQFHYGLDFADALGAPIRSVSSGTVIEAGPASGFGLWVRVLQDDGTTAVYGHVNDMYVQAGQRVNAGDVIATVGNRGQSTGPHLHLEIWDQGGNKIDPMPYLAAKGVPMHWGPSAH GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 128->242|YOMI_BACSU|3e-20|48.2|114/2285| SEG 3->34|aaasaavaagalvgvaaqvapalaaasplaps| SEG 61->87|aepapaadpapvtqvaapvaqnvaqqp| SEG 115->127|vappvavrpvaga| BL:PDB:NREP 1 BL:PDB:REP 140->240|2hsiB|1e-12|37.8|98/228| RP:PDB:NREP 1 RP:PDB:REP 128->240|2b13A|8e-25|37.2|113/131| RP:PFM:NREP 1 RP:PFM:REP 139->228|PF01551|4e-16|46.7|90/96|Peptidase_M23| HM:PFM:NREP 1 HM:PFM:REP 139->234|PF01551|3.4e-30|43.2|95/96|Peptidase_M23| RP:SCP:NREP 1 RP:SCP:REP 129->238|1qwyA|5e-23|38.2|110/234|b.84.3.2| HM:SCP:REP 55->238|1qwyA_|2.8e-40|31.0|184/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 1572 OP:NHOMOORG 683 OP:PATTERN -------------------------------------------------------------------- 111-131322211111122-241111222221212267AA1--1-2111351442-12--224-222775-------------1-3--454424112--2222331122----------------1213123313111111---22F534342433312233212456663-3-----3----44232221-1-44444343343543332111144411141351-----52-223232232222222----2------------------1------111-----------------------------------------332--11111111113-11-332214-1511637635444425455431-32-4221-1111113333333333333333333334-33343334333-433233333333324333111111111-------------33411----------2222121121221---124433323333111111-------11------111112211---2121111221221-121211111111112-2223232122453244353431333234454521-1222133332222222212233121--332221324324222253232232223432--1224311----11212111111111211-121111111211111111132312222111111111111111111111111311222222222221111111111111-242212111-1111-2--11111111---4255552333433334344---------133432222234333223343333344341-336677663332332355--------------------------1111111111--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------6--1--1------- -1------------------------------------------------------------------------------------------------------11--1----1--------1---1------------------------------------------------ STR:NPRED 119 STR:RPRED 47.2 SQ:SECSTR ###############################################################################################################################HHTccEEEcEEcTccEEEEccTTcEEEccccEEEEEEEEcccccEEEEEEETTccEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEccccGEccHHHHccccETTc###### DISOP:02AL 1-6, 22-41, 47-114, 248-252| PSIPRED ccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEcccccccEEEEccccEEEEEEEcccccEEEEEEccccEEEEEEEccccccccccEEEcccEEEEEEccccccccEEEEEEEEcccEEEccHHHHHccccccccccccc //