[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55571.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:330 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   18->239 1vplA PDBj 2e-32 34.7 %
:RPS:PDB   17->236 3b5jA PDBj 2e-43 24.3 %
:RPS:SCOP  19->244 1b0uA  c.37.1.12 * 4e-47 28.3 %
:HMM:SCOP  21->231 1ii8.1 c.37.1.12 * 3.7e-61 36.4 %
:RPS:PFM   46->85 PF00485 * PRK 2e-04 42.5 %
:RPS:PFM   58->178 PF00005 * ABC_tran 9e-10 36.8 %
:HMM:PFM   58->178 PF00005 * ABC_tran 3.2e-18 32.7 113/118  
:HMM:PFM   32->69 PF03215 * Rad17 2.1e-06 42.1 38/498  
:BLT:SWISS 18->325 DRRA_STRPE 3e-73 51.7 %
:PROS 150->164|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55571.1 GT:GENE BAD55571.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 788436..789428 GB:FROM 788436 GB:TO 789428 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55571.1 LENGTH 330 SQ:AASEQ MPSSPQAESAADGAVPPAVRVEDVRKSFGDVHALRGISFTAAKASVLGILGPNGAGKTTTVKILSTLLRPDSGTAVVAGHDVRKDPAGVRRSIMMTGQYAALDENLSGRENLELFGRLMGLSKSAARKRADTLLEEFDLVGAGRRAVRHYSGGMRRRVDIACGLVVRPEVVFLDEPTTGLDPRSRQGVWDLVRVLKDQGITVLLTTQYLEEADVLSDNIIVIDKGTVIAEGTADELKERTGGSYCEVVPLDPTQLRIAADALGDLVPAAVAAELNGGDRLSIPAPEGAATLAEALRRLDSAGVELADIALRRPSLDDVFLSITGHSGGHA GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 18->325|DRRA_STRPE|3e-73|51.7|296/330| PROS 150->164|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 18->239|1vplA|2e-32|34.7|222/238| RP:PDB:NREP 1 RP:PDB:REP 17->236|3b5jA|2e-43|24.3|218/243| RP:PFM:NREP 2 RP:PFM:REP 46->85|PF00485|2e-04|42.5|40/189|PRK| RP:PFM:REP 58->178|PF00005|9e-10|36.8|117/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 58->178|PF00005|3.2e-18|32.7|113/118|ABC_tran| HM:PFM:REP 32->69|PF03215|2.1e-06|42.1|38/498|Rad17| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 19->244|1b0uA|4e-47|28.3|226/258|c.37.1.12| HM:SCP:REP 21->231|1ii8.1|3.7e-61|36.4|209/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47363 OP:NHOMOORG 1169 OP:PATTERN UULDPNHLUTTPTOUQoJUPPRRazOSlnYhWF8CCFBGFGBCUaNYjMQ*zg8RhQVYOSJKEY299 SaxR*hgeoooabWXTWPO-Oj88W*PPPPPNvrqt****X*c*p**oqleR***PWdFF***l*y****hZZYY*bZWQ*cqC798BOOON5NDHF--DGPHKKcJUQP46776767999999FTRLRXLLSSVPoqq**LKJ*fkgmwfelchSTLHJEKEahYj***VGNEGGCGPGHGDiadUTkc8Yey************************frx**hprstqrn**YgghehecffgggffWYVXVqZaa**XMUQWsrPQ**XRSShbaefjjmrnjquqqpqmokmoqmmnZXZZXZZZbaZXYziidcckjlmr*q*********d*ep***Xghc*oisj*enRJ**ogcZilSdiZloOUYdNeXQQNJKLINeX***ZRt****************-ns*ig*p***SA**************HKO**********NMNNNNNN*bfJSob*66455444554597CD79998A99B8686JAECCC************************o********CP**x*pvns******YhnKOIMkaHHHHIHGSPQarkY**TdZzkWhtecnKcbaTUXhVaddXeu*X*FKKQCGHIIGD89AAAAAAAHOBEGMLllsNuXVJPHuOQSTRLScSPQSSSWSUXW5-CKUQM1--111*s**Y*tv**xw*v*uw-zwuv*uyvwv**xrtussq*****gfXllijjmlmmkikmkjj*ojmoonqT4************23GJGHFGHNNOMQJ*k*YYXXXVHKMLITMSbMNOMNESGNRsdzvvwy***t****g***DCCABCCBCIdmmvnoopnrwvsrTUQNPONNONHEEE75OTMLJJJJ68767768*CQ8786A-7CC7GC7ABB4BE8B5557UklUNp*onnCfP -312XWK-TE7GPXMGAE8AJJFMCNFFFAB9AFED9CABBA9A99CBCFEEMFBDHABDBD647534253274634-544978B732-DC6A878877872AKIA2PwbdPVWfVXIIEBHPJkmDrD**e4aOkHKHCcFIbOELEHGUEF*FTNLsHb*JjLbFzWb*TeQDEKHD*DGBEQpXc*9ygJI****f ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 326-330| PSIPRED cccccccccccccccccEEEEEEEEEEEccEEEEEccEEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHcccEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccccc //