[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55575.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->158 1yocB PDBj 7e-20 41.7 %
:RPS:PDB   30->154 3dkzB PDBj 3e-10 14.9 %
:RPS:SCOP  20->154 1yocA1  d.38.1.5 * 1e-09 44.6 %
:HMM:SCOP  11->161 1yocA1 d.38.1.5 * 4.6e-22 27.0 %
:HMM:PFM   79->104 PF10210 * MRP-S32 0.00076 38.5 26/96  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55575.1 GT:GENE BAD55575.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(792388..792870) GB:FROM 792388 GB:TO 792870 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55575.1 LENGTH 160 SQ:AASEQ MAMTDATATYRGWKKLPDNRIGHALFSLGMVARVPYFGTVLPTVVRLEPGLCEVSAPKWFGIRNHLGTFHAIAACNLAEVAMGMLSEATVPTTHRWIPKAMNVRYLTKAETGLRAVARLPRIPDFAAITEGTELVVPVAIYDKHGVEVVHADITTWVTPK GT:EXON 1|1-160:0| BL:PDB:NREP 1 BL:PDB:REP 20->158|1yocB|7e-20|41.7|132/147| RP:PDB:NREP 1 RP:PDB:REP 30->154|3dkzB|3e-10|14.9|114/120| HM:PFM:NREP 1 HM:PFM:REP 79->104|PF10210|0.00076|38.5|26/96|MRP-S32| RP:SCP:NREP 1 RP:SCP:REP 20->154|1yocA1|1e-09|44.6|130/145|d.38.1.5| HM:SCP:REP 11->161|1yocA1|4.6e-22|27.0|141/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 63 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- -----------1-1111--------1------1---1111-------1--------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111-1--------------------------------------------------------------------------1--------------------------------1--11-1-1111111111111111111--------------------------------------------------------------------------------------------------------------12-----------------111-1-------1111--1-1--------------------------------11-1-1------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 88.1 SQ:SECSTR ###################HHcHHHHHHHccccccHHHHTTcEEEEEcccEEEEEEcccGGGccTTccccHHHHHHHHHHHHHTHHHTTTTTcTTccEEEEEEEEEccccccEEEEEEEEEccEEEEEEcccEEEEEEEEEcTTccEEEEEEEEcGGGEH DISOP:02AL 1-6| PSIPRED cccHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHHHHHcEEEEEEEccccEEEEEEEEEEEEEcccccEEEEEEccHHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEEEEcc //