[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55589.1
DDBJ      :             putative MutT family protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  125/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->134 2pq1A PDBj 1e-09 36.2 %
:RPS:PDB   19->150 2b06A PDBj 7e-20 21.1 %
:RPS:SCOP  19->150 1vc8A1  d.113.1.1 * 1e-22 27.6 %
:HMM:SCOP  1->156 2fmlA2 d.113.1.6 * 4.7e-34 30.5 %
:RPS:PFM   21->137 PF00293 * NUDIX 3e-15 38.7 %
:HMM:PFM   20->148 PF00293 * NUDIX 9.3e-26 35.0 123/135  
:BLT:SWISS 9->131 MUTT_STRAM 1e-14 36.9 %
:PROS 49->70|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55589.1 GT:GENE BAD55589.1 GT:PRODUCT putative MutT family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(800338..800820) GB:FROM 800338 GB:TO 800820 GB:DIRECTION - GB:PRODUCT putative MutT family protein GB:PROTEIN_ID BAD55589.1 LENGTH 160 SQ:AASEQ MARRIDYHQDPHAPTANSVRPSAGTFVHRDGAVLLIRRSDNGNWSMPGGAHDPGESLSRTAVRETREETGIDVRLTGLVGIFTDPTHVIHYTSNDEVRQEFTVIYRAEAVGGSPTASNESICVEWVPVERIRSLPMDPSQRKRIDWALTRDEPYIDSDAR GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 9->131|MUTT_STRAM|1e-14|36.9|111/154| PROS 49->70|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 22->134|2pq1A|1e-09|36.2|105/134| RP:PDB:NREP 1 RP:PDB:REP 19->150|2b06A|7e-20|21.1|123/150| RP:PFM:NREP 1 RP:PFM:REP 21->137|PF00293|3e-15|38.7|111/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 20->148|PF00293|9.3e-26|35.0|123/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 19->150|1vc8A1|1e-22|27.6|123/126|d.113.1.1| HM:SCP:REP 1->156|2fmlA2|4.7e-34|30.5|151/0|d.113.1.6|1/1|Nudix| OP:NHOMO 198 OP:NHOMOORG 142 OP:PATTERN --1-----------1------11---1------11--------------------1-1-1-1--1--- --1-211222111-221----1--1--------2122111-123-1---111-111----111-1--2313-111-11----------------------------------------------------------111-----2-1-1-111-----------1----1-------------1--------123332322313252331---124341112111-------1---------------1------1-------111---------11-1---------1---------------------------------------1111111-1--------------1-------------------------11---------11--------------------11-11----------------------1-------------------------1-----------------------------------------------------------------------------------------------------------------21-1--------1---1------2--------------------------------------------------------------1---------------------------------1-----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 100.0 SQ:SECSTR EEccEEEETTcccccccEEEEEEEEEEETTTTEEEEEEEcccEEEcccccccTTccHHHHHHHHHHHHHcEEEEccEEEEEEEEEEEEEEETTcTTccEEEEEEEEEcEEEEccccccTTcEEEEEEGGGGGGccccTTHHHHHHHHHcTHcccHGHHHH DISOP:02AL 1-2, 156-160| PSIPRED cccccccccccccccccEEEEEEEEEEEEccEEEEEEEccccEEEccccEEcccccHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEcccccEEEEEEEEEEEEEccccccccccHHEEEEccHHHHHcccccHHHHHHHHHHHHccccccccccc //