[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55593.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->56 PF10099 * RskA 0.00022 19.2 52/175  
:HMM:PFM   51->112 PF08596 * Lgl_C 0.00031 22.4 58/395  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55593.1 GT:GENE BAD55593.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 807252..807656 GB:FROM 807252 GB:TO 807656 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55593.1 LENGTH 134 SQ:AASEQ MSRTRDRFGRLTAGLGAAAVVSCAVVAGAPHAAATVDELTVNSRNPQAGCVYQLTAKVNHWFEVWFYDNALVIAGSPVKPVNGVATIQWKPGRSGTHTLAALQGLAYEIKVDVGEPTLTGSATCGAGPLGWMGS GT:EXON 1|1-134:0| SEG 13->36|aglgaaavvscavvagaphaaatv| HM:PFM:NREP 2 HM:PFM:REP 5->56|PF10099|0.00022|19.2|52/175|RskA| HM:PFM:REP 51->112|PF08596|0.00031|22.4|58/395|Lgl_C| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEEEEcccEEEEEEcccEEEccccccccccEEEEEEEccccccEEEEEEcccEEEEEEEccccccEEcccccccccccccc //