[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55595.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->117 1rfeA PDBj 7e-07 33.7 %
:RPS:PDB   19->146 3ba3B PDBj 5e-15 10.7 %
:RPS:SCOP  20->146 1w9aA  b.45.1.1 * 1e-15 21.4 %
:HMM:SCOP  8->146 1rfeA_ b.45.1.1 * 1.7e-25 32.4 %
:RPS:PFM   33->80 PF01243 * Pyridox_oxidase 1e-04 43.8 %
:HMM:PFM   20->102 PF01243 * Pyridox_oxidase 2.5e-19 32.5 83/89  
:BLT:SWISS 19->129 PDXH2_THICR 5e-05 29.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55595.1 GT:GENE BAD55595.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(808616..809059) GB:FROM 808616 GB:TO 809059 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55595.1 LENGTH 147 SQ:AASEQ MTAPDRTTPLLDTGTEFGAKVAERLEREQVVWLTTVGPTGTPQPNPVWFQWRDGEFLLFSQPDTPKIRNIRRNPRVSVHFNSTVHGGDVVVFTGTARIAEDRPTEQEIAAFTAKYTEGLRDIPMTAEQFYADYSVPLRIAPDRLRGF GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 19->129|PDXH2_THICR|5e-05|29.1|110/213| BL:PDB:NREP 1 BL:PDB:REP 19->117|1rfeA|7e-07|33.7|95/153| RP:PDB:NREP 1 RP:PDB:REP 19->146|3ba3B|5e-15|10.7|122/142| RP:PFM:NREP 1 RP:PFM:REP 33->80|PF01243|1e-04|43.8|48/88|Pyridox_oxidase| HM:PFM:NREP 1 HM:PFM:REP 20->102|PF01243|2.5e-19|32.5|83/89|Pyridox_oxidase| GO:PFM:NREP 1 GO:PFM GO:0010181|"GO:FMN binding"|PF01243|IPR011576| RP:SCP:NREP 1 RP:SCP:REP 20->146|1w9aA|1e-15|21.4|126/142|b.45.1.1| HM:SCP:REP 8->146|1rfeA_|1.7e-25|32.4|139/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----2-------------------1-----------1-11-1---1------------------------1-----------2------------------------------------------------------11------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 97.3 SQ:SECSTR ####GccccHHHHHHcHHHHHHHHHTTEEEEEEEEcGGTGccEEEEEEccccTTcEEEEEETTcTTHHHHTTccEEEEEEEcTTcccccEEEEEEEEEEEccccHHHHHHHHHHcTTHHHHHHHHGGGEcTTTEEEEEEEccEEEEE DISOP:02AL 1-4| PSIPRED cccccccccccccccccHHHHHHHHHcccEEEEEEEcccccEEEEEEEEEEEccEEEEEEccccHHHHHHHHcccEEEEEEccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccccHHcccccEEEEEEEEEEEEEc //