[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55598.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->114 3bpxB PDBj 7e-05 36.7 %
:RPS:PDB   34->113 3cdhA PDBj 5e-07 18.8 %
:RPS:SCOP  35->112 2fbiA1  a.4.5.28 * 2e-10 21.8 %
:HMM:SCOP  1->122 1jgsA_ a.4.5.28 * 3.2e-19 30.3 %
:HMM:PFM   33->88 PF01047 * MarR 1.9e-07 28.6 56/59  
:BLT:SWISS 4->110 HPCR_SHIFL 8e-07 25.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55598.1 GT:GENE BAD55598.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(812820..813194) GB:FROM 812820 GB:TO 813194 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55598.1 LENGTH 124 SQ:AASEQ MAPESLTARLVTASRQLTAAVEAVLAAEQLTVDDWLVVEALAGVDELAMTDLRARTLTSAPTLSRVVDRLATRALLFREVDATDRRRVRLHLSKRGEALHRRVRPLVAEAEQAWSAARPAAEPV GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 4->110|HPCR_SHIFL|8e-07|25.2|107/148| SEG 16->32|qltaaveavlaaeqltv| BL:PDB:NREP 1 BL:PDB:REP 62->114|3bpxB|7e-05|36.7|49/138| RP:PDB:NREP 1 RP:PDB:REP 34->113|3cdhA|5e-07|18.8|80/129| HM:PFM:NREP 1 HM:PFM:REP 33->88|PF01047|1.9e-07|28.6|56/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 35->112|2fbiA1|2e-10|21.8|78/136|a.4.5.28| HM:SCP:REP 1->122|1jgsA_|3.2e-19|30.3|122/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----1--1--1--------------1----------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 73.4 SQ:SECSTR ################################HHHHHHHHHcccccHHHHHHHTTcHHHHHHHHHHHTTcEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHTTTcGGGHTTTccHHHH# DISOP:02AL 119-120, 122-124| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccccc //