[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55601.1
DDBJ      :             putative aliphatic amidase
Swiss-Prot:AMIE_NOCFA   RecName: Full=Aliphatic amidase;         EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;

Homologs  Archaea  6/68 : Bacteria  109/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
d.160.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->340 2uxyA PDBj e-163 82.9 %
:RPS:PDB   15->335 2e2lE PDBj 2e-49 31.5 %
:RPS:SCOP  10->269 1f89A  d.160.1.1 * 1e-38 22.2 %
:HMM:SCOP  8->276 1emsA2 d.160.1.1 * 1e-54 32.6 %
:RPS:PFM   51->187 PF00795 * CN_hydrolase 5e-12 40.0 %
:HMM:PFM   16->189 PF00795 * CN_hydrolase 1.9e-27 32.1 165/184  
:BLT:SWISS 1->345 AMIE_NOCFA 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55601.1 GT:GENE BAD55601.1 GT:PRODUCT putative aliphatic amidase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(815428..816465) GB:FROM 815428 GB:TO 816465 GB:DIRECTION - GB:PRODUCT putative aliphatic amidase GB:PROTEIN_ID BAD55601.1 LENGTH 345 SQ:AASEQ MRHGDISSSPDTVGVAVVNYKMPRLHTKAEVLDNCRRIADMLVGMKSGLPGMDLVVFPEYSTQGIMYDEQEMYDTAATVPGEETAIFSAACREAGVWGVFSITGEQHEDHPRKPPYNTLVLIDDHGEIVQKYRKILPWCPIEGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDCAMKGAELIVRCQGYMYPSKDQQVLMAKAMAWANNCYVAVANAAGFDGVYSYFGHSALIGFDGRTLGETGEEEYGIQYAQLSISAIRDARAHDQSQNHLFKLLHRGYSGVHAAGDGDRGVADCPFEFYKLWVTDAQQARERVEAITRDTVGVADCRVGSLPVEQTLEA GT:EXON 1|1-345:0| SW:ID AMIE_NOCFA SW:DE RecName: Full=Aliphatic amidase; EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase; SW:GN Name=amiE; OrderedLocusNames=NFA_7560; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->345|AMIE_NOCFA|0.0|100.0|345/345| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 208->221|awanncyvavanaa| BL:PDB:NREP 1 BL:PDB:REP 1->340|2uxyA|e-163|82.9|339/340| RP:PDB:NREP 1 RP:PDB:REP 15->335|2e2lE|2e-49|31.5|311/316| RP:PFM:NREP 1 RP:PFM:REP 51->187|PF00795|5e-12|40.0|130/171|CN_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 16->189|PF00795|1.9e-27|32.1|165/184|CN_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00795|IPR003010| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF00795|IPR003010| RP:SCP:NREP 1 RP:SCP:REP 10->269|1f89A|1e-38|22.2|252/271|d.160.1.1| HM:SCP:REP 8->276|1emsA2|1e-54|32.6|258/0|d.160.1.1|1/1|Carbon-nitrogen hydrolase| OP:NHOMO 178 OP:NHOMOORG 126 OP:PATTERN ---------------------1---------1--------------1---1---1-1----------- ----1--------------------1----------1121---------------------------2-------------------------111-------1------------------------------------------2------------1-------------------------------1--111111-1-121111------11-----------------------------------------------------------------------------------------------------------11-1----------------------------1--1--1------------------------221---2--1-------------2212--31-------1---121-----------------11111111----1------------------------------------------1-221211--------------12---1-------1---1-1-11----1----------------------------11------1---------1-------------2-2222222-----------1-------------------------------1--------1---------------------------------------11----------------------------------------------------11-1----------------------1-----22221121-2-1--1-1-----------------------------------------------------------------------------------------------1- ----------------1----------------------------------------------------------------------1----1---------------3------------------------------------------------------------1---------H--11--------21----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 98.6 SQ:SECSTR ccccccccGGccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcTTEEEEEccTTTTTcccTTTTTcGGGccccccTTHHHHHHHHHHHTcEEEEEEEEccccTTccGccEEEEEEEcTTccEEEEEEcccccTTTcccccccccccEEcGGGcEEEEEEGGGGGcHHHHHHHHHTTccEEEEEEccccccHHHHHHHHHHHHHHHTcEEEEEEcccccccccccccEEEEcTTccEEEEcccTTTcEEEEEEcHHHHHHHHHHccTTcHHHHTTccTTTTcTTcccccccHHHHHHHHTccccTTGGcGGcccccGGGGTcccccccccTcccc##### DISOP:02AL 1-7, 340-345| PSIPRED ccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEEcccccEEEEEcccccccccccccccccccEEEcccccEEEEEEEcccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccccEEEcccEEEEcccccEEEcccccccEEEEEEEcHHHHHHHHHHccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //