[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55614.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.6
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->94 2c06A PDBj 2e-11 29.3 %
:RPS:SCOP  2->94 1m1fA  b.34.6.2 * 2e-13 25.0 %
:HMM:SCOP  1->105 1ne8A_ b.34.6.2 * 1.9e-16 34.6 %
:RPS:PFM   18->92 PF02452 * PemK 2e-05 40.0 %
:HMM:PFM   4->100 PF02452 * PemK 3.1e-20 34.7 95/110  
:BLT:SWISS 1->94 MAZF_STAHJ 1e-04 37.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55614.1 GT:GENE BAD55614.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(840729..841049) GB:FROM 840729 GB:TO 841049 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55614.1 LENGTH 106 SQ:AASEQ MIFRGAVYEIKALPGARGHEQQGRRCAVIIQSDRFPASTVIVALTSTSAGHAIYRPEIELDGVRTRVLTDQIYTVAPERLGEFKGSLDREELAELDRGLMLKLGLL GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 1->94|MAZF_STAHJ|1e-04|37.6|93/121| SEG 95->105|ldrglmlklgl| RP:PDB:NREP 1 RP:PDB:REP 2->94|2c06A|2e-11|29.3|92/110| RP:PFM:NREP 1 RP:PFM:REP 18->92|PF02452|2e-05|40.0|75/108|PemK| HM:PFM:NREP 1 HM:PFM:REP 4->100|PF02452|3.1e-20|34.7|95/110|PemK| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF02452|IPR003477| RP:SCP:NREP 1 RP:SCP:REP 2->94|1m1fA|2e-13|25.0|92/107|b.34.6.2| HM:SCP:REP 1->105|1ne8A_|1.9e-16|34.6|104/0|b.34.6.2|1/1|Cell growth inhibitor/plasmid maintenance toxic component| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------1-----1-----1-1-----------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 86.8 SQ:SECSTR #ccTTEEEEE#cccccccccccccEEEEEcccHHHHHHHcEEcEEcccccccccTTccccTTcccEEccccccccccccccEEEEEccHHHHHH############ DISOP:02AL 106-107| PSIPRED cEEccEEEEEEccccccccccccccEEEEEccccccccEEEEEEccccccccccEEEEEEccEEEEEEEEEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHcccc //