[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55615.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->37 PF01402 * RHH_1 1.5e-06 27.3 33/39  
:BLT:SWISS 12->67 EX7S_MAGSA 8e-04 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55615.1 GT:GENE BAD55615.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(841046..841270) GB:FROM 841046 GB:TO 841270 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55615.1 LENGTH 74 SQ:AASEQ MGTLNVRTDQAMETALAKLTEGTGRTRSDAVRYAVLRTYKELLLEQATADAERLAADPDDQAEMLAIQRFMGVA GT:EXON 1|1-74:0| BL:SWS:NREP 1 BL:SWS:REP 12->67|EX7S_MAGSA|8e-04|32.1|56/100| HM:PFM:NREP 1 HM:PFM:REP 5->37|PF01402|1.5e-06|27.3|33/39|RHH_1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccc //