[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55617.1
DDBJ      :             putative ferric nocobactin-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  231/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->189 3eixA PDBj 3e-07 29.5 %
:RPS:PDB   45->329 3eiwA PDBj 2e-29 18.4 %
:RPS:SCOP  45->324 2chuA1  c.92.2.4 * 2e-29 19.1 %
:HMM:SCOP  41->322 2chuA1 c.92.2.4 * 4.6e-41 31.3 %
:RPS:PFM   118->217 PF01497 * Peripla_BP_2 8e-09 36.0 %
:HMM:PFM   63->298 PF01497 * Peripla_BP_2 5.9e-29 21.9 210/238  
:BLT:SWISS 46->265 YFIY_BACSU 7e-15 29.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55617.1 GT:GENE BAD55617.1 GT:PRODUCT putative ferric nocobactin-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(842751..843740) GB:FROM 842751 GB:TO 843740 GB:DIRECTION - GB:PRODUCT putative ferric nocobactin-binding protein GB:PROTEIN_ID BAD55617.1 LENGTH 329 SQ:AASEQ MHTMRSVGRTRVWARAALAVLAGALVLSVGACGSSEDGGSGGESVTITHARGETVIEGTPQKIVALGNQWLDSTLALGVTPAGYIDNVAVASKSTSPWQRPGSLDSATQISPSGNIAEQVAALEPDLILADPFIADQKTYDELSKVAPTLPALTSDAVTPWQEQITTLGKVLGKQDEASKVIAGVDDKIAGILAANPTLRGKTFASTWLAGPAQLMVLTDPNDGSAKVFEQLGMTIPQNLRDLPANQGRVALSPERVDELTADLLLAGYSPGMDERYRQLPGYAELPSVQKGAVVFLTTQEISAVNQPTALSVPYILDKLGPAFAAAAK GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 46->265|YFIY_BACSU|7e-15|29.5|207/325| TM:NTM 1 TM:REGION 12->33| SEG 11->31|rvwaraalavlagalvlsvga| SEG 33->44|gssedggsgges| BL:PDB:NREP 1 BL:PDB:REP 45->189|3eixA|3e-07|29.5|139/287| RP:PDB:NREP 1 RP:PDB:REP 45->329|3eiwA|2e-29|18.4|277/292| RP:PFM:NREP 1 RP:PFM:REP 118->217|PF01497|8e-09|36.0|100/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 63->298|PF01497|5.9e-29|21.9|210/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 45->324|2chuA1|2e-29|19.1|262/283|c.92.2.4| HM:SCP:REP 41->322|2chuA1|4.6e-41|31.3|268/0|c.92.2.4|1/1|"Helical backbone" metal receptor| OP:NHOMO 412 OP:NHOMOORG 232 OP:PATTERN -------------------------------------------------------------------- -----41166634211111-11--1211111111111K7A-1-14-113111321112111---425-191-----------2------------------------------------------------------22-----3-5--211-----------21---B--------------21-------1-33333323-32233314442333222143-2------75-11111111111111-----1-----------------------------------11111111111-------------1-----------1121111--1122-----1-1----------11--------------------------1-----------------------1---------1----22--------1------121111---------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------11-1---------------------------------------1----11111111111-1121111111111111111---21121-----------------1111111---11111111111---------------212----1---------111111-----------1----------------------1-11-----3-211------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 86.6 SQ:SECSTR ############################################EEEEETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEcccEETTcGGGccHHHHHHHcccEEcccccccHHHHHHTcccEEEEETTTTTTTTHHHHHHHccEEEEccTTcHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEEEEETTEEEEccTTcHHHHHHHHTTccHHHHTTGGGEETTEEEEcHHHHHHHcccEEEGccccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTTTccHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-7, 33-45| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccEEEcccccEEEEEcccHHHHHHHHcccEEEEEcccccccccccccccHHHcccccccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEcccccHHHHHHHHccccccccHHcccccccccccHHHHHHHcccEEEEEcccHHHHHHHHccHHHcccHHHccEEEEEcccHHHHcccccHHHHHHHHHHHHHHHHHHcc //