[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55623.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  44->220 1wdjA  c.52.1.27 * 2e-12 15.0 %
:HMM:SCOP  22->202 1wdjA_ c.52.1.27 * 1.3e-08 23.3 %
:HMM:PFM   83->167 PF05685 * DUF820 7.9e-09 23.5 81/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55623.1 GT:GENE BAD55623.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 847526..848227 GB:FROM 847526 GB:TO 848227 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55623.1 LENGTH 233 SQ:AASEQ MPSRAWGDRHSDYDGPMPCSQSGPPDLPEYLTWDELDQLPDEIARRIELWNGRVVWLWRGPAEHQAFTFALTAALKRCTKEAHTHRPDECWRADFETNVFFGPTGKNDFVTPDFLVYRCPDAPYQDIRATDVLIVGAVHSPSNTPSDIEDKKARYAKAQIPWYWEVVLDRERSAIRYVHAYALEAGHGRLPAGVRPLYPANYLLVGRWPADATPGIDLDVPFPIRIPWSELEF GT:EXON 1|1-233:0| HM:PFM:NREP 1 HM:PFM:REP 83->167|PF05685|7.9e-09|23.5|81/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 44->220|1wdjA|2e-12|15.0|153/186|c.52.1.27| HM:SCP:REP 22->202|1wdjA_|1.3e-08|23.3|163/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------3-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 20-22, 145-148| PSIPRED ccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEcEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEEEEccccccccccccEEEEEEccccccccccccEEEEEEEEccccccHHHHHcccHHHcccccEEEEEEEHHccHHHHHHHEEEHHcccEEcHHcccccccccEEEEEEccccccccEEEEccccccccHHHHcc //