[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55624.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   56->164 3cfuB PDBj 2e-20 14.9 %
:RPS:PFM   57->156 PF11611 * TRF2 1e-09 37.5 %
:HMM:PFM   57->166 PF11611 * TRF2 9.1e-20 29.9 107/123  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55624.1 GT:GENE BAD55624.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(848253..848789) GB:FROM 848253 GB:TO 848789 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55624.1 LENGTH 178 SQ:AASEQ MRQRHSPRAVGPRRLPVRIVIALTAICLWGTGCGGTAAGGDSGPEELPIPARSTLPVRDGALEFVVTRVEFGATHLGGPVTGADAAGRFAVARVEVTNTGDEPITFDYAHQQLIDSRGTAHTPDLPGSMSLNGEFRHDYNPGVGTTLQLAFDLPADTAPATLVLRAAPASPGAAIALR GT:EXON 1|1-178:0| SEG 30->40|gtgcggtaagg| SEG 166->176|aapaspgaaia| RP:PDB:NREP 1 RP:PDB:REP 56->164|3cfuB|2e-20|14.9|101/131| RP:PFM:NREP 1 RP:PFM:REP 57->156|PF11611|1e-09|37.5|96/120|TRF2| HM:PFM:NREP 1 HM:PFM:REP 57->166|PF11611|9.1e-20|29.9|107/123|TRF2| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------1------11-12-----1----1----------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 56.7 SQ:SECSTR #######################################################EEEETTEEEEEEEEEcc######ccEccccccccEEEEE#EEEcccccEEEEGGGEEEEcTTcccccEEEcGG#GTTcccEEEEcTTcEEEEEEEEcccccccEEEEcH############## DISOP:02AL 1-11, 35-52| PSIPRED ccccccccccccccccEEEEHHHHHHHHHccccccccccccccccccccccccccEEEEcEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEcccccEEEEcccEEEEEcccEEEcccccHHEEEccccccccccccccEEEEEEEcccccccEEEEEEcccccccEEEEEc //