[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55628.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->83 PF05139 * Erythro_esteras 0.0009 19.0 42/344  
:BLT:SWISS 1->87 KHTT_BACSU 6e-04 26.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55628.1 GT:GENE BAD55628.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 852089..852364 GB:FROM 852089 GB:TO 852364 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55628.1 LENGTH 91 SQ:AASEQ MDVDRVTVPGTGVLHHLRTRAGVRFALLTRGDDRQLLVYDQQWPDEPAQTITLAPDEADQLADLLHSAPLPDRVARLERRMSRLLAERDPA GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|KHTT_BACSU|6e-04|26.4|87/100| HM:PFM:NREP 1 HM:PFM:REP 41->83|PF05139|0.0009|19.0|42/344|Erythro_esteras| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------1--------111-----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 90-91| PSIPRED cccEEEccccccEEEEEEEccccEEEEEEEcccEEEEEEccccccccccEEEccHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHcccc //