[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55630.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->91 1r8dB PDBj 2e-04 27.9 %
:RPS:PDB   4->91 3d70A PDBj 6e-13 18.2 %
:RPS:SCOP  3->91 1jbgA  a.6.1.3 * 7e-10 26.4 %
:HMM:SCOP  3->109 1jbgA_ a.6.1.3 * 4.5e-27 39.0 %
:HMM:PFM   5->41 PF00376 * MerR 2.2e-16 45.9 37/38  
:HMM:PFM   46->106 PF09278 * MerR-DNA-bind 3.1e-14 41.0 61/65  
:BLT:SWISS 4->75 HMMR_RHILV 1e-06 29.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55630.1 GT:GENE BAD55630.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(853701..854108) GB:FROM 853701 GB:TO 854108 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55630.1 LENGTH 135 SQ:AASEQ MAELSIGELAARFGLATHVLRHWEDAGLLTPRRDAGGRRRYRADDVERVGVILIGKSVGFSLDEIRELFAQVADRSGRRRLLQAQHDRLTEHIARAEAARAAIEHALDCTAEDVRTCPHFRTALTAALPADPGQK GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 4->75|HMMR_RHILV|1e-06|29.2|72/129| SEG 32->45|rrdaggrrryradd| SEG 92->106|hiaraeaaraaieha| BL:PDB:NREP 1 BL:PDB:REP 6->91|1r8dB|2e-04|27.9|86/107| RP:PDB:NREP 1 RP:PDB:REP 4->91|3d70A|6e-13|18.2|88/276| HM:PFM:NREP 2 HM:PFM:REP 5->41|PF00376|2.2e-16|45.9|37/38|MerR| HM:PFM:REP 46->106|PF09278|3.1e-14|41.0|61/65|MerR-DNA-bind| RP:SCP:NREP 1 RP:SCP:REP 3->91|1jbgA|7e-10|26.4|87/106|a.6.1.3| HM:SCP:REP 3->109|1jbgA_|4.5e-27|39.0|105/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 66.7 SQ:SECSTR #cEEEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHH############################################ DISOP:02AL 125-135| PSIPRED cccccHHHHHHHHcccHHHHHHHHHHccccccccccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccc //