[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55632.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  134/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->189 2zbqA PDBj 7e-07 37.7 %
:RPS:PDB   50->212 3e05B PDBj 9e-19 16.0 %
:RPS:SCOP  47->202 1xxlA  c.66.1.41 * 4e-20 27.6 %
:HMM:SCOP  30->203 1hnnA_ c.66.1.15 * 1.7e-33 34.5 %
:RPS:PFM   48->178 PF01209 * Ubie_methyltran 3e-13 37.5 %
:HMM:PFM   56->155 PF08241 * Methyltransf_11 1.4e-21 38.3 94/95  
:BLT:SWISS 50->159 YT37_STRFR 2e-13 38.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55632.1 GT:GENE BAD55632.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 854708..855346 GB:FROM 854708 GB:TO 855346 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55632.1 LENGTH 212 SQ:AASEQ MASLVTKVLATVAGQLGNPHGVLGKGVALMLNRTNRAMIAAAVDAAEVGPGDIAADVGFGGGVGLSMLLDRVGPDGSVVGVELSPDMLSRARSGYAREIAADRLTLREGSLTELPQPDRSLDALITVNTLYFVPELDRACAELARVLRPGGRAVVAVGDPTDMAKLPFTEHGFRLRPVAELQAALTAAGLTVEHIGRPRKPVGLHLLVGRRS GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 50->159|YT37_STRFR|2e-13|38.3|107/345| SEG 37->46|amiaaavdaa| BL:PDB:NREP 1 BL:PDB:REP 50->189|2zbqA|7e-07|37.7|130/251| RP:PDB:NREP 1 RP:PDB:REP 50->212|3e05B|9e-19|16.0|150/192| RP:PFM:NREP 1 RP:PFM:REP 48->178|PF01209|3e-13|37.5|128/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 56->155|PF08241|1.4e-21|38.3|94/95|Methyltransf_11| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 47->202|1xxlA|4e-20|27.6|152/234|c.66.1.41| HM:SCP:REP 30->203|1hnnA_|1.7e-33|34.5|174/0|c.66.1.15|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 239 OP:NHOMOORG 178 OP:PATTERN ------------------------211---1-1----------1----11221--------------- -23-----------33-11-12----11111122422-11---2-1--------------2---1----11--------1--2-----111---------11---1--11---------------11-112--1-1-11-1111--111-------------------1--------------11---------------1----------111---1-1-1--1------------------------------1-----1-1------------------------------------------------------------111-2122212-1---11---------2---1-1112---12-------2-----------1-------1-11---------------1-------2-1-----------12---11------1-------------1------------------------------------1-------------------1--------1------------------1----11-------------------1-1-1-112111---1-21---------213-------------------------------1--1--------------------------123-------------------------------------------------------------------------------------------------------12----------------------------------------------------------------------11--------------------------------------------------------------------13- -------------------1321-1-111-----1--111111--1------1-----1111--1--------------------------1-1--1-----------4-3--------------------------------------------------------------1----27-------------2--1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 98.1 SQ:SECSTR ####HHHHHHHTcccccHHHHHHHHHHHTTccccHHHHHHHHHHHHTccTTcEEEEETcTTcHHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHHHHHHHHTcTTEEEEEccTTTTcTTcccccEEEEcccTTcHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHTTcEEEccEEccccccccccEEcccEEEEEccTEEEEEEEcc DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEEEcc //