[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55642.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.76.2
:123 amino acids
:PSIPRED
:RPS:SCOP  44->109 1h3iA1  b.76.2.1 * 4e-06 21.2 %
:HMM:SCOP  26->109 1h3iA1 b.76.2.1 * 4.2e-10 20.2 %
:HMM:PFM   59->102 PF12343 * DEADboxA 6e-05 42.9 42/63  
:BLT:SWISS 16->109 YWQK_BACSU 5e-09 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55642.1 GT:GENE BAD55642.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(861135..861506) GB:FROM 861135 GB:TO 861506 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55642.1 LENGTH 123 SQ:AASEQ MKRIDLTVDAVSYADDQRLEHDGEPFTGEVVEQVGGQLVSQQFYVDGIAHGPEREWWADGGRKAEGEMRHGMPVGVHRFWHRNGQLAEEREFDDAGRMIRRRKWDENGDPVEIAAGRRARRGI GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 16->109|YWQK_BACSU|5e-09|29.0|93/100| SEG 28->42|gevveqvggqlvsqq| SEG 114->122|aagrrarrg| HM:PFM:NREP 1 HM:PFM:REP 59->102|PF12343|6e-05|42.9|42/63|DEADboxA| RP:SCP:NREP 1 RP:SCP:REP 44->109|1h3iA1|4e-06|21.2|66/142|b.76.2.1| HM:SCP:REP 26->109|1h3iA1|4.2e-10|20.2|84/142|b.76.2.1|1/1|Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------1----------------------13------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccEEEEEccccEEEcccccccEEEEcccccEEEEEEEccccccccEEEEEccccEEEEEEEEccEEccEEEEEcccccEEEEEEEEccEEEEEEEEEcccccEEEEEEcccccccc //