[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55645.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->35 PF08273 * Prim_Zn_Ribbon 0.00072 54.5 11/40  
:HMM:PFM   77->91 PF08705 * Gag_p6 0.00081 60.0 15/37  
:BLT:SWISS 3->97 DNLJ_RALME 7e-06 37.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55645.1 GT:GENE BAD55645.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 869526..870095 GB:FROM 869526 GB:TO 870095 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55645.1 LENGTH 189 SQ:AASEQ MRGAAVPQSLPLARSNAEARVFLRLQPCHVCGSKDCAFDSAVLRVDGELVGRYRGGCAVCGAEREYLFRIPEQVLVPPAEGVRFGDERPSQLLDPGVWLWYSDRCARRLPEPGAALDDSRRRTARHTLATALAAVEEVLKFVPAGASAVPATAFTSVDGRAVYEREPGRFDAARLAALRDHYASTLASW GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 3->97|DNLJ_RALME|7e-06|37.6|85/721| SEG 120->139|rrrtarhtlatalaaveevl| SEG 171->180|daarlaalrd| HM:PFM:NREP 2 HM:PFM:REP 25->35|PF08273|0.00072|54.5|11/40|Prim_Zn_Ribbon| HM:PFM:REP 77->91|PF08705|0.00081|60.0|15/37|Gag_p6| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccccccccEEEEEEEccHHccccccccccHHHEEEcHHHHHHccccEEEEcccHHHHHHccHHHcccccccccccccccHHHccccEEEEEccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHcc //