[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55647.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->105 1wa8B1 a.25.3.1 * 0.00023 23.4 %
:HMM:PFM   3->98 PF10824 * DUF2580 4.1e-05 21.3 89/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55647.1 GT:GENE BAD55647.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(870630..870944) GB:FROM 870630 GB:TO 870944 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55647.1 LENGTH 104 SQ:AASEQ MGRVQVTSQSLSALAGDVESFGERLRRIADAADAATSPGPSAWGDDEFGTRFAEGEDAKGFRPGATTMSTNARTIATTFDNLAGGLATAAGELARLEQGNKLTF GT:EXON 1|1-104:0| SEG 29->35|adaadaa| SEG 82->94|lagglataagela| HM:PFM:NREP 1 HM:PFM:REP 3->98|PF10824|4.1e-05|21.3|89/100|DUF2580| HM:SCP:REP 2->105|1wa8B1|0.00023|23.4|94/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 101-104| PSIPRED cccccccHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccc //