Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55648.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:245 amino acids
:HMM:PFM   130->147 PF06298 * PsbY 0.00017 44.4 18/36  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55648.1 GT:GENE BAD55648.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(871027..871764) GB:FROM 871027 GB:TO 871764 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55648.1 LENGTH 245 SQ:AASEQ MAADTFAAERARLLAEGERLRALRDTDPDAVFALFDVHKQYEQLLPDVVVARCPFTGTPVSWPIDLVDLDGWYWDYDVPTRRLVDPVPPTWLAMGGAVRLSEPVTPAPFDCMPGPDRPYVVPRLLAREEVRAVVVELPIGAHTGWAITYFGTARPTDVALENLWGTRRYDTYDARGHWRGWAEHQQNTADYDFDLAPWLTSGKLRWIAPGDPTATLREGTDGCPYTAVDGDGRLQLVRQGRVIRF GT:EXON 1|1-245:0| SEG 7->24|aaerarllaegerlralr| SEG 123->137|rllareevravvvel| HM:PFM:NREP 1 HM:PFM:REP 130->147|PF06298|0.00017|44.4|18/36|PsbY| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccEEEEccccHHHHccccccHHHHcccEEEEcccccccccccccccccccHHHHHHHHHHHEEEEEEEcccccccEEEEEEcccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccccccccEEEEcccccccccccccccccEEEEccccEEEEEEcccEEcc //