[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55651.1
DDBJ      :             hypothetical protein
Swiss-Prot:DTD_NOCFA    RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase;         EC=3.1.-.-;

Homologs  Archaea  1/68 : Bacteria  620/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
c.110.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->143 2dboA PDBj 1e-26 46.4 %
:RPS:PDB   1->143 2dboA PDBj 7e-52 45.7 %
:RPS:SCOP  1->142 1j7gA  c.110.1.1 * 4e-50 44.9 %
:HMM:SCOP  1->143 1j7gA_ c.110.1.1 * 2.2e-49 58.3 %
:RPS:PFM   2->142 PF02580 * Tyr_Deacylase 4e-38 60.1 %
:HMM:PFM   2->143 PF02580 * Tyr_Deacylase 7.8e-49 53.2 139/145  
:BLT:SWISS 1->143 DTD_NOCFA 3e-78 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55651.1 GT:GENE BAD55651.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(874347..874778) GB:FROM 874347 GB:TO 874778 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55651.1 LENGTH 143 SQ:AASEQ MRVLVQRVTSAQVTVDGEVVGRIEPNPQGLVALVGVTHGDDDATARALADKLWRLRILDGERSAADLGAPILVVSQFTLYADTAKGRRPSWSAAAPGPVAEPLVDAFAATLRELGATVATGRFGAHMHVELTNDGPVTLLLES GT:EXON 1|1-143:0| SW:ID DTD_NOCFA SW:DE RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase; EC=3.1.-.-; SW:GN Name=dtd; OrderedLocusNames=NFA_8060; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|DTD_NOCFA|3e-78|100.0|143/143| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 1->143|2dboA|1e-26|46.4|140/148| RP:PDB:NREP 1 RP:PDB:REP 1->143|2dboA|7e-52|45.7|140/148| RP:PFM:NREP 1 RP:PFM:REP 2->142|PF02580|4e-38|60.1|138/144|Tyr_Deacylase| HM:PFM:NREP 1 HM:PFM:REP 2->143|PF02580|7.8e-49|53.2|139/145|Tyr_Deacylase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF02580|IPR003732| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF02580|IPR003732| GO:PFM GO:0019478|"GO:D-amino acid catabolic process"|PF02580|IPR003732| RP:SCP:NREP 1 RP:SCP:REP 1->142|1j7gA|4e-50|44.9|138/144|c.110.1.1| HM:SCP:REP 1->143|1j7gA_|2.2e-49|58.3|139/144|c.110.1.1|1/1|DTD-like| OP:NHOMO 820 OP:NHOMOORG 792 OP:PATTERN ---------------------------------1---------------------------------- -11-111111111111111-11--1111111111111-111---111-1------11---111111111111111111-11111-11111111111---11111111111--------------111-11----111111111111111111-----------1-----11------------1111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111---------------------------------------------------------------1111111111--------------------------------------------------------1111111111111111111111111111--111-111111111-111----111111111---11111111111111111111111111111111111----------------------11---1-1111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1-----------------1-------------------------1111111111111 1111111-3111-1111-1-11111-1111111-11121111111-111111111111111111-111-1111111111112221111-111111111111-1111-11-211111111-1111121211A1-111-1111-111-1-11111-11111--11111-111-1113-111711-11111111111211-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEEEEETTEEEEEEccEEcEEEEEEEccTTccHHHHHHHHHHHHHcccccccccTTTTTcEEEEEEcGGGGcccccccccccTTcccHHHHHHHHHHHHHHHHTTcccEEEcccccccEEEEEEEEEEEEEEEG DISOP:02AL 92-97| PSIPRED cEEEEEEEEEEEEEEccEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHccEEcccccccEEccccEEEEEcHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEccEEEEEEEEcccEEEEEEc //