[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55652.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:668 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  76->141 1g59A2  c.26.1.1 * 8e-04 23.8 %
:HMM:PFM   351->387 PF01469 * Pentapeptide_2 3.7e-10 62.2 37/40  
:HMM:PFM   199->286 PF00823 * PPE 1.5e-07 20.5 88/159  
:BLT:SWISS 546->606 PACC_ASPPA 2e-05 36.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55652.1 GT:GENE BAD55652.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 874967..876973 GB:FROM 874967 GB:TO 876973 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55652.1 LENGTH 668 SQ:AASEQ MGAESAWSGLAGARKVSVWPDAALQSANACSDMIAAIKGYKNLYDGQGLGKFTGAQFGGLDSGGRLATAFNDRAVDIYEQFDKHIETLTDLVELFKAAGAAYKGTDHQSGDTLRRLGEVVGDPTAKNIPWTKPDQNAQNGKFYFPRTMLNDSEPAVPKGLSQPPPAVQFAPVTVTVKPEEPESMSWSELYDLGQKIDVWPLMTVAPIWGEIADKSYDAAYDLYRKLQVITTDSWRSDGADQAVQAIGKYAESVVALSRGIQVMETNIEYTADWLHRTKTEMPSQPEKPCGGPSLGDYQAEFGKYYVTGALQSEKSFPMVSDPPGPGAPPPPPRTDDPGKGDPRGDGPRGDNPGTGNPGSGNPGSGNPGSGNPGSGNPGSAKPGSGNPAATPTPSPAPTAQTPQIPGAGDPNATQNPTGTPAPGSTGTGTGTGQSPTGQRDTGQGMPMLSALTSAMSSMLPALAQAVPALAQALPGLTQALQQLPQQQAAAAGVDTGALAQLFDRFPELRTILADSPQLAELIAAHPELRPLGDVLGIPAGPQSIEPQATEPQTTESQTTGQNTARPAETSGAPAPADSGGSRLFPRAALPDTSLAPFPTPGVPADPGVAVSAGPSRAAAYESGAGWTVPGVVAGSTPGEPLVRQSIDGVEQEAVDEDSLHYARPVVES GT:EXON 1|1-668:0| BL:SWS:NREP 1 BL:SWS:REP 546->606|PACC_ASPPA|2e-05|36.1|61/662| SEG 321->405|dppgpgappppprtddpgkgdprgdgprgdnpgtgnpgsgnpgsgnpgsgnpgsgnpgsakpgsgnpaatptpspaptaqtpqip| SEG 416->438|ptgtpapgstgtgtgtgqsptgq| SEG 445->491|mpmlsaltsamssmlpalaqavpalaqalpgltqalqqlpqqqaaaa| HM:PFM:NREP 2 HM:PFM:REP 351->387|PF01469|3.7e-10|62.2|37/40|Pentapeptide_2| HM:PFM:REP 199->286|PF00823|1.5e-07|20.5|88/159|PPE| RP:SCP:NREP 1 RP:SCP:REP 76->141|1g59A2|8e-04|23.8|63/305|c.26.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 101-195, 221-657, 667-668| PSIPRED cccHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHcccccccccHHHcccccHHHHHHHcccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccc //