Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55654.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:HMM:PFM   23->53 PF11887 * DUF3407 4.6e-05 42.3 26/267  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55654.1 GT:GENE BAD55654.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 877960..878271 GB:FROM 877960 GB:TO 878271 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55654.1 LENGTH 103 SQ:AASEQ MGVENYPSLLDKAAQKTGEVRDRINAVLTTLSSALAGRGAPWGNDKIGDQFTQGENGYFVSRENLTTSAANMATTFDNFSTSQTDAAFHLRTMDLGNGDQYRT GT:EXON 1|1-103:0| HM:PFM:NREP 1 HM:PFM:REP 23->53|PF11887|4.6e-05|42.3|26/267|DUF3407| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 98-103| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccHHHHHHHHcccccccccccEEEEEEEEccccccccc //