Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55659.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55659.1 GT:GENE BAD55659.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 904045..904830 GB:FROM 904045 GB:TO 904830 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55659.1 LENGTH 261 SQ:AASEQ MNQTWKFTDLEFYALWYDSEREALPWPFFFATRTELDSVFRVEQAEALANARRTHGALCREVIEALVRPDLRIIASGRDGREPRKPAGLVRIHAVRRGDRGFVVNQLPGETFYHGTSFTVAECDAVALAEAVVRAMPDATPGRLADVTLAARADTEEFDYSYGRSAVQDSFDDSVAERAARFLAEPVQHQGSIEVIQGRSLFGPRGITRHRLEWRDLLDDGRYVVDDQHPPLAVAADRKRLISMINIRVAEVVRAIKDERP GT:EXON 1|1-261:0| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------31------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 258-261| PSIPRED ccccEEEcHHHHHHHHHHcccccccccEEcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccEEEEEEEccccccccccEEEEEEEEEEEcEEEEEEEcccccccccccEEEEEEcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccccEEEEEEccccccEEEEcccccEEccccHHHHHHHHHHHHHHHHHHHHcccc //